3.30 Rating by CuteStat

srisaiapna.com is 7 years 10 months old. It is a domain having com extension. It has a global traffic rank of #4878958 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, srisaiapna.com is SAFE to browse.

PageSpeed Score
32
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 173
Daily Pageviews: 346

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 29
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 474
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 4,878,958
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011
:: Welcome to Sri Sai Apna Motor Driving School - Home Page ::

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 2 Total Images: 30
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 20 Dec 2019 05:38:59 GMT
Server: Apache
Last-Modified: Thu, 14 Mar 2019 04:49:36 GMT
Accept-Ranges: bytes
Content-Length: 14046
Content-Type: text/html

Domain Information

Domain Registrar: Nimzo 27, LLC
Registration Date: May 30, 2016, 4:42 PM 7 years 10 months 4 weeks ago
Expiration Date: May 30, 2020, 4:42 PM 3 years 10 months 3 weeks ago
Domain Status:
ok

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
srisaiapna.com A 10799 IP: 103.24.200.143
srisaiapna.com NS 86400 Target: ns2.lazybulls.com
srisaiapna.com NS 86400 Target: ns1.lazybulls.com
srisaiapna.com SOA 10800 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2019061804
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
srisaiapna.com MX 14400 Target: srisaiapna.com
srisaiapna.com TXT 14400 TXT: v=spf1 ip4:103.24.200.143
ip4:103.24.200.141 +a +mx ~all

Similarly Ranked Websites

neutrallust

- neutrallust.com
4,878,959 $ 240.00

Всё о глазах и зрении

- about-vision.ru

Строение глаз, нарушения зрения и способы их коррекции, уход и макияж. Информация для тех, кто носит очки, линзы, а также хочет сохранить здоровье глаз.

4,878,961 $ 240.00

Emro.gr

- emro.gr

Οδηγός online shopping και χρήσιμες συμβουλές. Διακοπές, ταξίδια, μόδα, σπίτι, μαγειρική, γάμος, βάπτιση...

4,878,968 $ 240.00

Главная | Главный информационный портал Красногорска

- krasnogorsk.ru

Главный информационный портал Красногорска

4,878,969 $ 240.00

DoggySwag

- doggyswag.site

YOUR DESCRIPTION HERE

4,878,972 $ 240.00

Full WHOIS Lookup

Domain Name: SRISAIAPNA.COM
Registry Domain ID: 2032248288_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2019-05-31T05:45:51Z
Creation Date: 2016-05-30T10:57:11Z
Registrar Registration Expiration Date: 2020-05-30T10:57:11Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: OK https://icann.org/epp#OK
Registry Registrant ID: Not Available From Registry
Registrant Name: Purushotham Reddy O-17145
Registrant Organization: Sri Sai Apna
Registrant Street: 8-38-957 Punjagutta School, Srinagar Colony
Registrant City: Hyderabad
Registrant State/Province: Telangana
Registrant Postal Code: 500034
Registrant Country: IN
Registrant Phone: +91.9246365655
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: srisaiapna@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Purushotham Reddy O-17145
Admin Organization: Sri Sai Apna
Admin Street: 8-38-957 Punjagutta School, Srinagar Colony
Admin City: Hyderabad
Admin State/Province: Telangana
Admin Postal Code: 500034
Admin Country: IN
Admin Phone: +91.9246365655
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: srisaiapna@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Purushotham Reddy O-17145
Tech Organization: Sri Sai Apna
Tech Street: 8-38-957 Punjagutta School, Srinagar Colony
Tech City: Hyderabad
Tech State/Province: Telangana
Tech Postal Code: 500034
Tech Country: IN
Tech Phone: +91.9246365655
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: srisaiapna@gmail.com
Name Server: ns1.lazybulls.com
Name Server: ns2.lazybulls.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-20T05:39:24Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: LAZY BULLS DOMAIN AND HOSTING SERVICES

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.